PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G0924
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family YABBY
Protein Properties Length: 197aa    MW: 21697.9 Da    PI: 8.8016
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G0924genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY1433.1e-4491551163
        YABBY   1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvss 98 
                  +d++ +se++Cyv+CnfCnt+lav +P + l+++vtv+CGhC++l  ++ +   q +         l ++   +l++   +++        + t+ +s
  Gh_A03G0924   9 MDLVPQSEHLCYVRCNFCNTVLAVGIPCKRLLETVTVKCGHCSNLSFLSTRPPLQGQ--------CLDPQTSLTLQSFCGDFR--------KGTQFPS 90 
                  578899*************************************98553333322222........222223333333322222........2233333 PP

        YABBY  99 eklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                   + s++++ ++p++p v++PPek+ r Psaynrf+keeiqrika+nP+i hreafsaaaknWa +
  Gh_A03G0924  91 PSSSTSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY 155
                  334667778899***************************************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.3E-5314155IPR006780YABBY protein
SuperFamilySSF470959.43E-999153IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.104.0E-5109154IPR009071High mobility group box domain
CDDcd013904.53E-6116152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MNLEDKVGMD LVPQSEHLCY VRCNFCNTVL AVGIPCKRLL ETVTVKCGHC SNLSFLSTRP  60
PLQGQCLDPQ TSLTLQSFCG DFRKGTQFPS PSSSTSSEPS SPKAPFVVKP PEKKHRLPSA  120
YNRFMKEEIQ RIKAANPEIP HREAFSAAAK NWARYIPNSP AASSVCGSSS NVSNQIHYIY  180
IYNGKNVLIM GFGEGLL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8548040.0AY854804.1 Gossypium hirsutum isolate 1 CRABS CLAW mRNA, partial cds.
GenBankAY8548050.0AY854805.1 Gossypium hirsutum isolate 2 CRABS CLAW mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012481221.11e-125PREDICTED: protein CRABS CLAW isoform X2
SwissprotQ8L9251e-70CRC_ARATH; Protein CRABS CLAW
TrEMBLA0A0D2NCW11e-125A0A0D2NCW1_G
STRINGVIT_01s0011g00140.t012e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM97252835
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.19e-68YABBY family protein